SV2B purified MaxPab rabbit polyclonal antibody (D01P)
  • SV2B purified MaxPab rabbit polyclonal antibody (D01P)

SV2B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009899-D01P
SV2B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SV2B protein.
Información adicional
Size 100 ug
Gene Name SV2B
Gene Alias HsT19680|KIAA0735
Gene Description synaptic vesicle glycoprotein 2B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDDYKYQDNYGGYAPSDGYYRGNESNPEEDAQSDVTEGHDEEDEIYEGEYQGIPHPDDVKAKQAKMAPSRMDSLRGQTDLMAERLEDEEQLAHQYETIMDECGHGRFQWILFFVLGLALMADGVEVFVVSFALPSAEKDMCLSSSKKGMLGMIVYLGMMAGAFILGGLADKLGRKRVLSMSLAVNASFASLSSFVQGYGAFLFCRLISGIGIGGALPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGLYASAMAW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SV2B (NP_055663.1, 1 a.a. ~ 683 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9899

Enviar uma mensagem


SV2B purified MaxPab rabbit polyclonal antibody (D01P)

SV2B purified MaxPab rabbit polyclonal antibody (D01P)