NUAK1 polyclonal antibody (A01)
  • NUAK1 polyclonal antibody (A01)

NUAK1 polyclonal antibody (A01)

Ref: AB-H00009891-A01
NUAK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NUAK1.
Información adicional
Size 50 uL
Gene Name NUAK1
Gene Alias ARK5|KIAA0537
Gene Description NUAK family, SNF1-like kinase, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq SKKENDFAQSGQDAVPESPSKLSSKRPKGILKKRSNSEHRSHSTGFIEGVVGPALPSTFKMEQDLCRTGVLLPSSPEAEVPGKLSPKQSATMPKKGILKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NUAK1 (NP_055655, 371 a.a. ~ 470 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9891

Enviar uma mensagem


NUAK1 polyclonal antibody (A01)

NUAK1 polyclonal antibody (A01)