SEC24D monoclonal antibody (M04), clone 1A8
  • SEC24D monoclonal antibody (M04), clone 1A8

SEC24D monoclonal antibody (M04), clone 1A8

Ref: AB-H00009871-M04
SEC24D monoclonal antibody (M04), clone 1A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SEC24D.
Información adicional
Size 100 ug
Gene Name SEC24D
Gene Alias FLJ43974|KIAA0755
Gene Description SEC24 family, member D (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQPEMVFRQFLVEDKGLYGGSSYVDFLCCVHKEICQLLN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEC24D (NP_055637, 935 a.a. ~ 1032 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9871
Clone Number 1A8
Iso type IgG1 Kappa

Enviar uma mensagem


SEC24D monoclonal antibody (M04), clone 1A8

SEC24D monoclonal antibody (M04), clone 1A8