PJA2 monoclonal antibody (M01), clone 1G11
  • PJA2 monoclonal antibody (M01), clone 1G11

PJA2 monoclonal antibody (M01), clone 1G11

Ref: AB-H00009867-M01
PJA2 monoclonal antibody (M01), clone 1G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PJA2.
Información adicional
Size 100 ug
Gene Name PJA2
Gene Alias KIAA0438|Neurodap1|RNF131
Gene Description praja ring finger 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq REKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRWREALEVEESGSDDLLIKCEEYDGEHDCMFLDPPYSRVITQRETENNQMTSESGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PJA2 (NP_055634, 302 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9867
Clone Number 1G11
Iso type IgG2a Kappa

Enviar uma mensagem


PJA2 monoclonal antibody (M01), clone 1G11

PJA2 monoclonal antibody (M01), clone 1G11