PJA2 polyclonal antibody (A01)
  • PJA2 polyclonal antibody (A01)

PJA2 polyclonal antibody (A01)

Ref: AB-H00009867-A01
PJA2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PJA2.
Información adicional
Size 50 uL
Gene Name PJA2
Gene Alias KIAA0438|Neurodap1|RNF131
Gene Description praja ring finger 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq REKNHGSSPEQVVRPKVRKLISSSQVDQETGFNRHEAKQRSVQRWREALEVEESGSDDLLIKCEEYDGEHDCMFLDPPYSRVITQRETENNQMTSESGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PJA2 (NP_055634, 302 a.a. ~ 400 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9867

Enviar uma mensagem


PJA2 polyclonal antibody (A01)

PJA2 polyclonal antibody (A01)