PSMD6 monoclonal antibody (M01), clone 1C1
  • PSMD6 monoclonal antibody (M01), clone 1C1

PSMD6 monoclonal antibody (M01), clone 1C1

Ref: AB-H00009861-M01
PSMD6 monoclonal antibody (M01), clone 1C1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PSMD6.
Información adicional
Size 100 ug
Gene Name PSMD6
Gene Alias KIAA0107|Rpn7|S10|SGA-113M|p44S10
Gene Description proteasome (prosome, macropain) 26S subunit, non-ATPase, 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,RNAi-Ab
Immunogen Prot. Seq YRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSMD6 (NP_055629, 292 a.a. ~ 389 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9861
Clone Number 1C1
Iso type IgG1 Kappa

Enviar uma mensagem


PSMD6 monoclonal antibody (M01), clone 1C1

PSMD6 monoclonal antibody (M01), clone 1C1