PSMD6 purified MaxPab rabbit polyclonal antibody (D01P)
  • PSMD6 purified MaxPab rabbit polyclonal antibody (D01P)

PSMD6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009861-D01P
PSMD6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PSMD6 protein.
Información adicional
Size 100 ug
Gene Name PSMD6
Gene Alias KIAA0107|Rpn7|S10|SGA-113M|p44S10
Gene Description proteasome (prosome, macropain) 26S subunit, non-ATPase, 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PSMD6 (NP_055629.1, 1 a.a. ~ 389 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9861

Enviar uma mensagem


PSMD6 purified MaxPab rabbit polyclonal antibody (D01P)

PSMD6 purified MaxPab rabbit polyclonal antibody (D01P)