PLEKHM1 monoclonal antibody (M01), clone 1C9
  • PLEKHM1 monoclonal antibody (M01), clone 1C9

PLEKHM1 monoclonal antibody (M01), clone 1C9

Ref: AB-H00009842-M01
PLEKHM1 monoclonal antibody (M01), clone 1C9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PLEKHM1.
Información adicional
Size 100 ug
Gene Name PLEKHM1
Gene Alias AP162|B2|KIAA0356|OPTB6
Gene Description pleckstrin homology domain containing, family M (with RUN domain) member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq PHRFSVADLQQIADGVYEGFLKALIEFASQHVYHCDLCTQRGFICQICQHHDIIFPFEFDTTVRCAECKTVFHQSCQAVVKKGCPRCARRRKYQEQNIFA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLEKHM1 (AAH64361, 957 a.a. ~ 1056 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9842
Clone Number 1C9
Iso type IgG2b Kappa

Enviar uma mensagem


PLEKHM1 monoclonal antibody (M01), clone 1C9

PLEKHM1 monoclonal antibody (M01), clone 1C9