MELK monoclonal antibody (M01), clone 4D8
  • MELK monoclonal antibody (M01), clone 4D8

MELK monoclonal antibody (M01), clone 4D8

Ref: AB-H00009833-M01
MELK monoclonal antibody (M01), clone 4D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MELK.
Información adicional
Size 100 ug
Gene Name MELK
Gene Alias HPK38|KIAA0175
Gene Description maternal embryonic leucine zipper kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq ARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MELK (AAH14039, 550 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9833
Clone Number 4D8
Iso type IgG1 Kappa

Enviar uma mensagem


MELK monoclonal antibody (M01), clone 4D8

MELK monoclonal antibody (M01), clone 4D8