SPATA2 purified MaxPab mouse polyclonal antibody (B01P)
  • SPATA2 purified MaxPab mouse polyclonal antibody (B01P)

SPATA2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009825-B01P
SPATA2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SPATA2 protein.
Información adicional
Size 50 ug
Gene Name SPATA2
Gene Alias FLJ13167|KIAA0757|PD1|tamo
Gene Description spermatogenesis associated 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGKPSSMDTKFKDDLFRKYVQFHESKVDTTTSRQRPGSDECLRVAASTLLSLHKVDPFYRFRLIQFYEVVESSLRSLSSSSLRALHGAFSMLETVGINLFLYPWKKEFRSIKTYTGPFVYYVKSTLLEEDIRAILSCMGYTPELGTAYKLRELVETLQVKMVSFELFLAKVECEQMLEIHSQVKDKGYSELDIVSERKSSAEDVRGCSDALRRRAEGREHLTASMSRVALQKSASERAAKDYYKPRVTKPSRSVD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SPATA2 (NP_006029.1, 1 a.a. ~ 520 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9825

Enviar uma mensagem


SPATA2 purified MaxPab mouse polyclonal antibody (B01P)

SPATA2 purified MaxPab mouse polyclonal antibody (B01P)