ARMCX2 purified MaxPab mouse polyclonal antibody (B01P)
  • ARMCX2 purified MaxPab mouse polyclonal antibody (B01P)

ARMCX2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009823-B01P
ARMCX2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ARMCX2 protein.
Información adicional
Size 50 ug
Gene Name ARMCX2
Gene Alias ALEX2|KIAA0512|MGC13343|MGC8742
Gene Description armadillo repeat containing, X-linked 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSRVRDAGCVAAGIVIGAGAWYCVYKYTRGRDQTKKRMAKPKNRAVAGTGARARAGLRAGFTIDLGSGFSPPTPVRAEAEDRAQDEASALDTVGAEAVAPAASSAEAQSGAGSQAQEADGAGVGPKAESVVGAAMASAIAPPPGVTEALGAAEAPAMAGAPKVAEAPREAETSRAAVPPGTVVPTEAAAPTEVTEGPGVAAPTKVAEAPGVASPTEAAEAPVPATPTGAAAPTGAAESPGTSGSPRTAVVPGTSA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARMCX2 (NP_055597.1, 1 a.a. ~ 632 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9823

Enviar uma mensagem


ARMCX2 purified MaxPab mouse polyclonal antibody (B01P)

ARMCX2 purified MaxPab mouse polyclonal antibody (B01P)