CUL7 monoclonal antibody (M01), clone 2G11
  • CUL7 monoclonal antibody (M01), clone 2G11

CUL7 monoclonal antibody (M01), clone 2G11

Ref: AB-H00009820-M01
CUL7 monoclonal antibody (M01), clone 2G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CUL7.
Información adicional
Size 100 ug
Gene Name CUL7
Gene Alias KIAA0076|dJ20C7.5
Gene Description cullin 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGDGGSGQVDCKAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESAGEVG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CUL7 (AAH33647, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9820
Clone Number 2G11
Iso type IgG1 kappa

Enviar uma mensagem


CUL7 monoclonal antibody (M01), clone 2G11

CUL7 monoclonal antibody (M01), clone 2G11