NUPL1 monoclonal antibody (M01), clone 3G11
  • NUPL1 monoclonal antibody (M01), clone 3G11

NUPL1 monoclonal antibody (M01), clone 3G11

Ref: AB-H00009818-M01
NUPL1 monoclonal antibody (M01), clone 3G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NUPL1.
Información adicional
Size 100 ug
Gene Name NUPL1
Gene Alias KIAA0410|PRO2463
Gene Description nucleoporin like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq EIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGYRK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NUPL1 (NP_054808.1, 323 a.a. ~ 422 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9818
Clone Number 3G11
Iso type IgG2b Kappa

Enviar uma mensagem


NUPL1 monoclonal antibody (M01), clone 3G11

NUPL1 monoclonal antibody (M01), clone 3G11