GIT2 monoclonal antibody (M04), clone 1B2
  • GIT2 monoclonal antibody (M04), clone 1B2

GIT2 monoclonal antibody (M04), clone 1B2

Ref: AB-H00009815-M04
GIT2 monoclonal antibody (M04), clone 1B2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GIT2.
Información adicional
Size 100 ug
Gene Name GIT2
Gene Alias CAT-2|DKFZp686G01261|KIAA0148|MGC760
Gene Description G protein-coupled receptor kinase interacting ArfGAP 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq TDLETTASKTNRQKLQTLQSENSNLRKQATTNVYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPEESRMRLQPFPAHA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GIT2 (NP_055591, 401 a.a. ~ 498 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9815
Clone Number 1B2
Iso type IgG1 Kappa

Enviar uma mensagem


GIT2 monoclonal antibody (M04), clone 1B2

GIT2 monoclonal antibody (M04), clone 1B2