RNF40 polyclonal antibody (A01)
  • RNF40 polyclonal antibody (A01)

RNF40 polyclonal antibody (A01)

Ref: AB-H00009810-A01
RNF40 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RNF40.
Información adicional
Size 50 uL
Gene Name RNF40
Gene Alias BRE1B|DKFZp686K191|KIAA0661|MGC13051|RBP95|STARING
Gene Description ring finger protein 40
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DETVEALLRCHESQGELSSAPEAPGTQEGPTCDGTPLPEPGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELELQGRMEFSKAAVSRVVEASD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF40 (NP_055586, 102 a.a. ~ 200 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9810

Enviar uma mensagem


RNF40 polyclonal antibody (A01)

RNF40 polyclonal antibody (A01)