SPOCK2 purified MaxPab mouse polyclonal antibody (B01P)
  • SPOCK2 purified MaxPab mouse polyclonal antibody (B01P)

SPOCK2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009806-B01P
SPOCK2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SPOCK2 protein.
Información adicional
Size 50 ug
Gene Name SPOCK2
Gene Alias FLJ97039|testican-2
Gene Description sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRAPGCGRLVLPLLLLAAAALAEGDAKGLKEGETPGNFMEDEQWLSSISQYSGKIKHWNRFRDEVEDDYIKSWEDNQQGDEALDTTKDPCQKVKCSRHKVCIAQGYQRAMCISRKKLEHRIKQPTVKLHGNKDSICKPCHMAQLASVCGSDGHTYSSVCKLEQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDSIGWMFS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SPOCK2 (NP_055582, 1 a.a. ~ 424 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9806

Enviar uma mensagem


SPOCK2 purified MaxPab mouse polyclonal antibody (B01P)

SPOCK2 purified MaxPab mouse polyclonal antibody (B01P)