MTSS1 monoclonal antibody (M01), clone 2G9
  • MTSS1 monoclonal antibody (M01), clone 2G9

MTSS1 monoclonal antibody (M01), clone 2G9

Ref: AB-H00009788-M01
MTSS1 monoclonal antibody (M01), clone 2G9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MTSS1.
Información adicional
Size 50 ug
Gene Name MTSS1
Gene Alias DKFZp781P2223|FLJ44694|KIAA0429|MIM|MIMA|MIMB
Gene Description metastasis suppressor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq GVLPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MTSS1 (AAH23998, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9788
Clone Number 2G9
Iso type IgG1 Kappa

Enviar uma mensagem


MTSS1 monoclonal antibody (M01), clone 2G9

MTSS1 monoclonal antibody (M01), clone 2G9