RNF144A purified MaxPab mouse polyclonal antibody (B02P)
  • RNF144A purified MaxPab mouse polyclonal antibody (B02P)

RNF144A purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00009781-B02P
RNF144A purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RNF144A protein.
Información adicional
Size 50 ug
Gene Name RNF144A
Gene Alias KIAA0161|RNF144|UBCE7IP4
Gene Description ring finger protein 144A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MTTTRYRPTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDDAPIKRCPKCKVYIERDEGCAQMMCKNCKHAFCWYCLESLDDDFLLIHYDKGPCRNKLGHSRASVIWHRTQVVGIFA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RNF144A (NP_055561.2, 1 a.a. ~ 292 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9781

Enviar uma mensagem


RNF144A purified MaxPab mouse polyclonal antibody (B02P)

RNF144A purified MaxPab mouse polyclonal antibody (B02P)