KIAA0101 purified MaxPab mouse polyclonal antibody (B01P)
  • KIAA0101 purified MaxPab mouse polyclonal antibody (B01P)

KIAA0101 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009768-B01P
KIAA0101 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KIAA0101 protein.
Información adicional
Size 50 ug
Gene Name KIAA0101
Gene Alias L5|NS5ATP9|OEATC-1|OEATC1|PAF|p15(PAF)
Gene Description KIAA0101
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KIAA0101 (NP_055551.1, 1 a.a. ~ 111 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9768

Enviar uma mensagem


KIAA0101 purified MaxPab mouse polyclonal antibody (B01P)

KIAA0101 purified MaxPab mouse polyclonal antibody (B01P)