Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ZFYVE16 monoclonal antibody (M04), clone 2E2
Abnova
ZFYVE16 monoclonal antibody (M04), clone 2E2
Ref: AB-H00009765-M04
ZFYVE16 monoclonal antibody (M04), clone 2E2
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ZFYVE16.
Información adicional
Size
100 ug
Gene Name
ZFYVE16
Gene Alias
DKFZp686E13162|ENDOFIN|KIAA0305
Gene Description
zinc finger, FYVE domain containing 16
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
MDSYFKAAVSDLDKLLDDFEQNPDEQDYLQDVQNAYDSNHCSVSSELASSQRTSLLPKDQECVNSCASSETSYGTNESSLNEKTLKGLTSIQNEKNVTGL
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ZFYVE16 (NP_055548, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
9765
Clone Number
2E2
Iso type
IgG2b Kappa
Enviar uma mensagem
ZFYVE16 monoclonal antibody (M04), clone 2E2
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*