STARD8 purified MaxPab mouse polyclonal antibody (B01P)
  • STARD8 purified MaxPab mouse polyclonal antibody (B01P)

STARD8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009754-B01P
STARD8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human STARD8 protein.
Información adicional
Size 50 ug
Gene Name STARD8
Gene Alias DKFZp686H1668|DLC3|KIAA0189|STARTGAP3
Gene Description StAR-related lipid transfer (START) domain containing 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTLNNCASMKLEVHFQSKQNEDSEEEEQCTISSHWAFQQESKCWSPMGSSDLLAPPSPGLPATSSCESVLTELSATSLPVITVSLPPEPADLPLPGRAPSSSDRPLLSPTQGQEGPQDKAKKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKVSKASSFRSCRGFLSAGFYRAKNWAATSAGGSGANTRKAWEAWPVASFRHPQWTHRGDCLVHVPGDHKPGTFPRSLSIESLCPEDGHRLADWQPGRR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STARD8 (NP_055540.2, 1 a.a. ~ 1023 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9754

Enviar uma mensagem


STARD8 purified MaxPab mouse polyclonal antibody (B01P)

STARD8 purified MaxPab mouse polyclonal antibody (B01P)