USP34 monoclonal antibody (M01), clone 2E2
  • USP34 monoclonal antibody (M01), clone 2E2

USP34 monoclonal antibody (M01), clone 2E2

Ref: AB-H00009736-M01
USP34 monoclonal antibody (M01), clone 2E2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant USP34.
Información adicional
Size 100 ug
Gene Name USP34
Gene Alias FLJ43910|KIAA0570|KIAA0729|MGC104459
Gene Description ubiquitin specific peptidase 34
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq CKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDLADLRSCDGQALPSQDPEVALSLSCGHSRGLFSHMQQHDILDTLCRTIESTIHVVTRISGKGNQAAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP34 (NP_055524, 3296 a.a. ~ 3395 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9736
Clone Number 2E2
Iso type IgG2a Kappa

Enviar uma mensagem


USP34 monoclonal antibody (M01), clone 2E2

USP34 monoclonal antibody (M01), clone 2E2