USP34 polyclonal antibody (A01)
  • USP34 polyclonal antibody (A01)

USP34 polyclonal antibody (A01)

Ref: AB-H00009736-A01
USP34 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant USP34.
Información adicional
Size 50 uL
Gene Name USP34
Gene Alias FLJ43910|KIAA0570|KIAA0729|MGC104459
Gene Description ubiquitin specific peptidase 34
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CKEFKDLHCSKDSTLAEEESEFPSTSISAVLSDLADLRSCDGQALPSQDPEVALSLSCGHSRGLFSHMQQHDILDTLCRTIESTIHVVTRISGKGNQAAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP34 (NP_055524, 3296 a.a. ~ 3395 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9736

Enviar uma mensagem


USP34 polyclonal antibody (A01)

USP34 polyclonal antibody (A01)