KNTC1 monoclonal antibody (M02), clone 10D9
  • KNTC1 monoclonal antibody (M02), clone 10D9

KNTC1 monoclonal antibody (M02), clone 10D9

Ref: AB-H00009735-M02
KNTC1 monoclonal antibody (M02), clone 10D9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KNTC1.
Información adicional
Size 100 ug
Gene Name KNTC1
Gene Alias FLJ36151|KIAA0166|ROD
Gene Description kinetochore associated 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DPQVILKQLEEHMNTGQLAGFSHQIRSLILNNIINKKEFGILAKTKYFQMLKMHAMNTNNITELVNYLANDLSLDEASVLITEYSKHCGKPVPPDTAPCEILKMFLSGLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KNTC1 (NP_055523, 2100 a.a. ~ 2209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9735
Clone Number 10D9
Iso type IgG2a Kappa

Enviar uma mensagem


KNTC1 monoclonal antibody (M02), clone 10D9

KNTC1 monoclonal antibody (M02), clone 10D9