SART3 MaxPab mouse polyclonal antibody (B01)
  • SART3 MaxPab mouse polyclonal antibody (B01)

SART3 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00009733-B01
SART3 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human SART3 protein.
Información adicional
Size 50 uL
Gene Name SART3
Gene Alias DSAP1|KIAA0156|MGC138188|P100|RP11-13G14|TIP110|p110|p110(nrb)
Gene Description squamous cell carcinoma antigen recognized by T cells 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MATAAETSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWDQQEEGVSESDGDEYAMASSAESSPGEYEWEYDEEEEKNQLEIERLEEQVGPGVGSGHLPVFQVLGSPCPGPPP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SART3 (AAH41638.1, 1 a.a. ~ 129 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9733

Enviar uma mensagem


SART3 MaxPab mouse polyclonal antibody (B01)

SART3 MaxPab mouse polyclonal antibody (B01)