DOCK4 polyclonal antibody (A01)
  • DOCK4 polyclonal antibody (A01)

DOCK4 polyclonal antibody (A01)

Ref: AB-H00009732-A01
DOCK4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DOCK4.
Información adicional
Size 50 uL
Gene Name DOCK4
Gene Alias FLJ34238|KIAA0716|MGC134911|MGC134912
Gene Description dedicator of cytokinesis 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPVPLPHSLSIPVTSEPPALPPKPLAARSSHLENGARRTDPGPRPRPLPRKVSQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DOCK4 (NP_055520, 1867 a.a. ~ 1966 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9732

Enviar uma mensagem


DOCK4 polyclonal antibody (A01)

DOCK4 polyclonal antibody (A01)