NOS1AP monoclonal antibody (M02), clone 3B11
  • NOS1AP monoclonal antibody (M02), clone 3B11

NOS1AP monoclonal antibody (M02), clone 3B11

Ref: AB-H00009722-M02
NOS1AP monoclonal antibody (M02), clone 3B11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NOS1AP.
Información adicional
Size 100 ug
Gene Name NOS1AP
Gene Alias 6330408P19Rik|CAPON|MGC138500
Gene Description nitric oxide synthase 1 (neuronal) adaptor protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq WTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NOS1AP (NP_055512.1, 99 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9722
Clone Number 3B11
Iso type IgG2a Kappa

Enviar uma mensagem


NOS1AP monoclonal antibody (M02), clone 3B11

NOS1AP monoclonal antibody (M02), clone 3B11