NOS1AP purified MaxPab mouse polyclonal antibody (B01P)
  • NOS1AP purified MaxPab mouse polyclonal antibody (B01P)

NOS1AP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009722-B01P
NOS1AP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NOS1AP protein.
Información adicional
Size 50 ug
Gene Name NOS1AP
Gene Alias 6330408P19Rik|CAPON|MGC138500
Gene Description nitric oxide synthase 1 (neuronal) adaptor protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPSKTKYNLVDDGHDLRIPLHNEDAFQHGICFEAKYVGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKKKVSIMVSVDGVKVILKKKKKLLLLQKKEWTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSNSSGDPGRQLTGAERASTATAEETDIDAVEVPLPGNDVLEFSRGVTDLDAVGKEGGSHTGSKV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NOS1AP (NP_055512.1, 1 a.a. ~ 506 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9722

Enviar uma mensagem


NOS1AP purified MaxPab mouse polyclonal antibody (B01P)

NOS1AP purified MaxPab mouse polyclonal antibody (B01P)