HERPUD1 monoclonal antibody (M04), clone 2G7
  • HERPUD1 monoclonal antibody (M04), clone 2G7

HERPUD1 monoclonal antibody (M04), clone 2G7

Ref: AB-H00009709-M04
HERPUD1 monoclonal antibody (M04), clone 2G7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HERPUD1.
Información adicional
Size 100 ug
Gene Name HERPUD1
Gene Alias HERP|KIAA0025|Mif1|SUP
Gene Description homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,IP,S-ELISA,ELISA
Immunogen Prot. Seq PKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HERPUD1 (NP_055500, 74 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9709
Clone Number 2G7
Iso type IgG2a Kappa

Enviar uma mensagem


HERPUD1 monoclonal antibody (M04), clone 2G7

HERPUD1 monoclonal antibody (M04), clone 2G7