HERPUD1 purified MaxPab rabbit polyclonal antibody (D01P)
  • HERPUD1 purified MaxPab rabbit polyclonal antibody (D01P)

HERPUD1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009709-D01P
HERPUD1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HERPUD1 protein.
Información adicional
Size 100 ug
Gene Name HERPUD1
Gene Alias HERP|KIAA0025|Mif1|SUP
Gene Description homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQYYMQYLAATAASGAFVPPPSAQEIPVVSAPAPAPIHNQFPAENQPANQNAAPQVVVNPGANQNLRMNAQGGPIVE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HERPUD1 (NP_055500.1, 1 a.a. ~ 391 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9709

Enviar uma mensagem


HERPUD1 purified MaxPab rabbit polyclonal antibody (D01P)

HERPUD1 purified MaxPab rabbit polyclonal antibody (D01P)