HERPUD1 polyclonal antibody (A01)
  • HERPUD1 polyclonal antibody (A01)

HERPUD1 polyclonal antibody (A01)

Ref: AB-H00009709-A01
HERPUD1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HERPUD1.
Información adicional
Size 50 uL
Gene Name HERPUD1
Gene Alias HERP|KIAA0025|Mif1|SUP
Gene Description homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HERPUD1 (NP_055500, 74 a.a. ~ 180 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9709

Enviar uma mensagem


HERPUD1 polyclonal antibody (A01)

HERPUD1 polyclonal antibody (A01)