CEP57 purified MaxPab rabbit polyclonal antibody (D01P)
  • CEP57 purified MaxPab rabbit polyclonal antibody (D01P)

CEP57 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009702-D01P
CEP57 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CEP57 protein.
Información adicional
Size 100 ug
Gene Name CEP57
Gene Alias KIAA0092|PIG8|TSP57
Gene Description centrosomal protein 57kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKRMQAKAAELQTGLETNRLIFEDKATPCVPN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CEP57 (NP_055494.2, 1 a.a. ~ 500 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9702

Enviar uma mensagem


CEP57 purified MaxPab rabbit polyclonal antibody (D01P)

CEP57 purified MaxPab rabbit polyclonal antibody (D01P)