CEP57 polyclonal antibody (A02)
  • CEP57 polyclonal antibody (A02)

CEP57 polyclonal antibody (A02)

Ref: AB-H00009702-A02
CEP57 polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CEP57.
Información adicional
Size 50 uL
Gene Name CEP57
Gene Alias KIAA0092|PIG8|TSP57
Gene Description centrosomal protein 57kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CEP57 (NP_055494, 19 a.a. ~ 128 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9702

Enviar uma mensagem


CEP57 polyclonal antibody (A02)

CEP57 polyclonal antibody (A02)