SAPS2 purified MaxPab mouse polyclonal antibody (B01P)
  • SAPS2 purified MaxPab mouse polyclonal antibody (B01P)

SAPS2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009701-B01P
SAPS2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SAPS2 protein.
Información adicional
Size 50 ug
Gene Name SAPS2
Gene Alias KIAA0685|PP6R2|SAP190|dJ579N16.1
Gene Description SAPS domain family, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MFWKFDLNTTSHVDKLLDKEHVTLQELMDEDDILQECKAQNQKLLDFLCRQQCMEELVSLITQDPPLDMEEKVRFKYPNTACELLTCDVPQISDRLGGDESLLSLLYDFLDHEPPLNPLLASFFSKTIGNLIARKTEQVITFLKKKDKFISLVLKHIGTSALMDLLLRLVSCVEPAGLRQDVLHWLNEEKVIQRLVELIHPSQDEDRQSNASQTLCDIVRLGRDQGSQLQEALEPDPLLTALESQDCVEQLLKNM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SAPS2 (NP_055493.2, 1 a.a. ~ 932 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9701

Enviar uma mensagem


SAPS2 purified MaxPab mouse polyclonal antibody (B01P)

SAPS2 purified MaxPab mouse polyclonal antibody (B01P)