EDEM1 monoclonal antibody (M02), clone 2D3
  • EDEM1 monoclonal antibody (M02), clone 2D3

EDEM1 monoclonal antibody (M02), clone 2D3

Ref: AB-H00009695-M02
EDEM1 monoclonal antibody (M02), clone 2D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EDEM1.
Información adicional
Size 100 ug
Gene Name EDEM1
Gene Alias EDEM|FLJ51559|FLJ51560|KIAA0212
Gene Description ER degradation enhancer, mannosidase alpha-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq YLLFDEDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFSEEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EDEM1 (NP_055489.1, 559 a.a. ~ 656 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9695
Clone Number 2D3
Iso type IgG2a Kappa

Enviar uma mensagem


EDEM1 monoclonal antibody (M02), clone 2D3

EDEM1 monoclonal antibody (M02), clone 2D3