KIAA0103 purified MaxPab mouse polyclonal antibody (B01P)
  • KIAA0103 purified MaxPab mouse polyclonal antibody (B01P)

KIAA0103 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009694-B01P
KIAA0103 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KIAA0103 protein.
Información adicional
Size 50 ug
Gene Name TTC35
Gene Alias KIAA0103
Gene Description tetratricopeptide repeat domain 35
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVMIAALDYGRDDLALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEELMMTNPHNHLYCQQYAEVKYTQGGLENLELSRKYFAQALKLNNRNMRALFGLYMSASHIASNPKASAKTKKDNMK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KIAA0103 (NP_055488, 1 a.a. ~ 297 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9694

Enviar uma mensagem


KIAA0103 purified MaxPab mouse polyclonal antibody (B01P)

KIAA0103 purified MaxPab mouse polyclonal antibody (B01P)