UBE3C polyclonal antibody (A01)
  • UBE3C polyclonal antibody (A01)

UBE3C polyclonal antibody (A01)

Ref: AB-H00009690-A01
UBE3C polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UBE3C.
Información adicional
Size 50 uL
Gene Name UBE3C
Gene Alias KIAA0010|KIAA10
Gene Description ubiquitin protein ligase E3C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq IQLFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKVTQLYVPASRHVWRFRRMGRIGPLQSTLDVGLESPPLSVSEERQLAVLTELPFVVPFEER
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE3C (NP_055486, 599 a.a. ~ 698 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9690

Enviar uma mensagem


UBE3C polyclonal antibody (A01)

UBE3C polyclonal antibody (A01)