EIF5B polyclonal antibody (A01)
  • EIF5B polyclonal antibody (A01)

EIF5B polyclonal antibody (A01)

Ref: AB-H00009669-A01
EIF5B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EIF5B.
Información adicional
Size 50 uL
Gene Name EIF5B
Gene Alias DKFZp434I036|FLJ10524|IF2|KIAA0741
Gene Description eukaryotic translation initiation factor 5B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QGTPMCVPSKNFVDIGIVTSIEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRDEMQKSDWQLIVELKKVFE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF5B (NP_056988, 1121 a.a. ~ 1218 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9669

Enviar uma mensagem


EIF5B polyclonal antibody (A01)

EIF5B polyclonal antibody (A01)