DZIP3 polyclonal antibody (A01)
  • DZIP3 polyclonal antibody (A01)

DZIP3 polyclonal antibody (A01)

Ref: AB-H00009666-A01
DZIP3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DZIP3.
Información adicional
Size 50 uL
Gene Name DZIP3
Gene Alias FLJ13327|FLJ57977|FLJ58022|FLJ58223|KIAA0675|UURF2|hRUL138
Gene Description DAZ interacting protein 3, zinc finger
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PSAGLRSDPSIMNWERITDRLKTAFPQQTRKELTDFLRKLKDAYGKSLSELTFDEIVCKISQFIDPKKSQSQGKSVSNVNCVSPSHSPSQPDAAQPPKPA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DZIP3 (NP_055463, 1021 a.a. ~ 1120 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9666

Enviar uma mensagem


DZIP3 polyclonal antibody (A01)

DZIP3 polyclonal antibody (A01)