IQCB1 purified MaxPab mouse polyclonal antibody (B01P)
  • IQCB1 purified MaxPab mouse polyclonal antibody (B01P)

IQCB1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009657-B01P
IQCB1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IQCB1 protein.
Información adicional
Size 50 ug
Gene Name IQCB1
Gene Alias NPHP5|PIQ|SLSN5
Gene Description IQ motif containing B1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKPTGTDPRILSIAAEVAKSPEQNVPVILLKLKEIINITPLGSSELKKIKQDIYCYDLIQYCLLVLSQDYSRIQGGWTTISQLTQILSHCCVGLEPGEDAEEFYNELLPSAAENFLVLGRQLQTCFINAAKAEEKDELLHFFQIVTDSLFWLLGGHVELIQNVLQSDHFLHLLQADNVQIGSAVMMMLQNILQINRSKRSKMLLEINRQKEEEDLKLQLQLQRQRAMRLSRELQLSMLEIVHPGQVEKHYREMEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IQCB1 (NP_001018865, 1 a.a. ~ 465 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9657

Enviar uma mensagem


IQCB1 purified MaxPab mouse polyclonal antibody (B01P)

IQCB1 purified MaxPab mouse polyclonal antibody (B01P)