ARHGEF10 monoclonal antibody (M02), clone 6G5
  • ARHGEF10 monoclonal antibody (M02), clone 6G5

ARHGEF10 monoclonal antibody (M02), clone 6G5

Ref: AB-H00009639-M02
ARHGEF10 monoclonal antibody (M02), clone 6G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ARHGEF10.
Información adicional
Size 100 ug
Gene Name ARHGEF10
Gene Alias DKFZp686H0726|GEF10|MGC131664
Gene Description Rho guanine nucleotide exchange factor (GEF) 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GKQDKSGRPTFFTAVFNTFTPAIKESWVNSLQMAKLALEEENHMGWFCVEDDGNHIKKEKHPLLVGHMPVMVAKQQEFKIECAAYNPEPYLNNESQPDS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARHGEF10 (NP_055444, 792 a.a. ~ 890 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9639
Clone Number 6G5
Iso type IgG2a Kappa

Enviar uma mensagem


ARHGEF10 monoclonal antibody (M02), clone 6G5

ARHGEF10 monoclonal antibody (M02), clone 6G5