NCOR1 polyclonal antibody (A01)
  • NCOR1 polyclonal antibody (A01)

NCOR1 polyclonal antibody (A01)

Ref: AB-H00009611-A01
NCOR1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NCOR1.
Información adicional
Size 50 uL
Gene Name NCOR1
Gene Alias KIAA1047|MGC104216|N-CoR|TRAC1|hCIT529I10|hN-CoR
Gene Description nuclear receptor co-repressor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTMRMLSSTPPTPIACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NCOR1 (NP_006302, 2341 a.a. ~ 2440 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9611

Enviar uma mensagem


NCOR1 polyclonal antibody (A01)

NCOR1 polyclonal antibody (A01)