RIN1 polyclonal antibody (A01)
  • RIN1 polyclonal antibody (A01)

RIN1 polyclonal antibody (A01)

Ref: AB-H00009610-A01
RIN1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RIN1.
Información adicional
Size 50 uL
Gene Name RIN1
Gene Alias -
Gene Description Ras and Rab interactor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VPPEASIATLNQLCATKFRVTQPNTFGLFLYKEQGYHRLPPGALAHRLPTTGYLVYRRAEWPETQGAVTEEEGSGQSEARSRGEEQGCQGDGDAGVKASPRDIREQSETT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RIN1 (AAH14417, 646 a.a. ~ 755 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9610

Enviar uma mensagem


RIN1 polyclonal antibody (A01)

RIN1 polyclonal antibody (A01)