CART monoclonal antibody (M01), clone 3E4
  • CART monoclonal antibody (M01), clone 3E4

CART monoclonal antibody (M01), clone 3E4

Ref: AB-H00009607-M01
CART monoclonal antibody (M01), clone 3E4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CART.
Información adicional
Size 100 ug
Gene Name CARTPT
Gene Alias CART
Gene Description CART prepropeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CART (AAH29882, 1 a.a. ~ 116 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9607
Clone Number 3E4
Iso type IgG2a Kappa

Enviar uma mensagem


CART monoclonal antibody (M01), clone 3E4

CART monoclonal antibody (M01), clone 3E4