RNF14 MaxPab mouse polyclonal antibody (B01)
  • RNF14 MaxPab mouse polyclonal antibody (B01)

RNF14 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00009604-B01
RNF14 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human RNF14 protein.
Información adicional
Size 50 uL
Gene Name RNF14
Gene Alias ARA54|FLJ26004|HFB30|HRIHFB2038|TRIAD2
Gene Description ring finger protein 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RNF14 (NP_899645.1, 1 a.a. ~ 348 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 9604

Enviar uma mensagem


RNF14 MaxPab mouse polyclonal antibody (B01)

RNF14 MaxPab mouse polyclonal antibody (B01)