PDIA4 purified MaxPab mouse polyclonal antibody (B01P)
  • PDIA4 purified MaxPab mouse polyclonal antibody (B01P)

PDIA4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00009601-B01P
PDIA4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PDIA4 protein.
Información adicional
Size 50 ug
Gene Name PDIA4
Gene Alias ERP70|ERP72
Gene Description protein disulfide isomerase family A, member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MRPRKAFLLLLLLGLVQLLAVAGAEGPDEDSSNRENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PDIA4 (NP_004902.1, 1 a.a. ~ 645 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9601

Enviar uma mensagem


PDIA4 purified MaxPab mouse polyclonal antibody (B01P)

PDIA4 purified MaxPab mouse polyclonal antibody (B01P)