CREB5 monoclonal antibody (M02), clone 8A5
  • CREB5 monoclonal antibody (M02), clone 8A5

CREB5 monoclonal antibody (M02), clone 8A5

Ref: AB-H00009586-M02
CREB5 monoclonal antibody (M02), clone 8A5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CREB5.
Información adicional
Size 100 ug
Gene Name CREB5
Gene Alias CRE-BPA
Gene Description cAMP responsive element binding protein 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MFCTSGGNSASVMSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CREB5 (NP_001011666, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9586
Clone Number 8A5
Iso type IgG2a Kappa

Enviar uma mensagem


CREB5 monoclonal antibody (M02), clone 8A5

CREB5 monoclonal antibody (M02), clone 8A5