SOX13 polyclonal antibody (A01)
  • SOX13 polyclonal antibody (A01)

SOX13 polyclonal antibody (A01)

Ref: AB-H00009580-A01
SOX13 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SOX13.
Información adicional
Size 50 uL
Gene Name SOX13
Gene Alias ICA12|MGC117216|Sox-13
Gene Description SRY (sex determining region Y)-box 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KSEEKKEPCHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNFRGSWDCSSPEGNGSPEPKRPGVSEAASGSQEKLDFNRNLKEVVPAIEKLLSSDWKERFLGRNSMEAKDV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOX13 (NP_005677, 25 a.a. ~ 138 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9580

Enviar uma mensagem


SOX13 polyclonal antibody (A01)

SOX13 polyclonal antibody (A01)