View larger
Mouse monoclonal antibody raised against a partial recombinant CDC42BPB.
AB-H00009578-M01
New product
CDC42BPB monoclonal antibody (M01), clone 5F12
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | CDC42BPB |
| Gene Alias | KIAA1124|MRCKB |
| Gene Description | CDC42 binding protein kinase beta (DMPK-like) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA,IF |
| Immunogen Prot. Seq | SKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTP |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CDC42BPB (AAD37506, 1580 a.a. ~ 1679 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 9578 |
| Clone Number | 5F12 |
| Iso type | IgG2a Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant CDC42BPB.