CDC42BPB polyclonal antibody (A01)
  • CDC42BPB polyclonal antibody (A01)

CDC42BPB polyclonal antibody (A01)

Ref: AB-H00009578-A01
CDC42BPB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CDC42BPB.
Información adicional
Size 50 uL
Gene Name CDC42BPB
Gene Alias KIAA1124|MRCKB
Gene Description CDC42 binding protein kinase beta (DMPK-like)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC42BPB (AAD37506, 1580 a.a. ~ 1679 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9578

Enviar uma mensagem


CDC42BPB polyclonal antibody (A01)

CDC42BPB polyclonal antibody (A01)